Primary Antibodies

Jump to Filters
View as table Download
WNT10B Rabbit Polyclonal Antibody
TA306582

USD 430.00

In Stock

Rabbit Polyclonal Wnt10b Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b.
WNT10B Rabbit Polyclonal Antibody
TA344059

USD 475.00

5 Days

Rabbit Polyclonal Anti-WNT10B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
WNT10B Rabbit Polyclonal Antibody
TA324853

USD 450.00

5 Days

Rabbit polyclonal WNT10B Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B.
WNT10B Rabbit Polyclonal Antibody
TA351953

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-WNT10B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT10B