Primary Antibodies

View as table Download

NUDT9 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 317-347 amino acids from the C-terminal region of Human NUDT9

Rabbit Polyclonal Anti-NUDT9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUDT9 antibody: synthetic peptide directed towards the C terminal of human NUDT9. Synthetic peptide located within the following region: LEAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHA