Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TMPRSS11D Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS11D antibody: synthetic peptide directed towards the N terminal of human TMPRSS11D. Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA

Rabbit Polyclonal Anti-TMPRSS11D Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMPRSS11D antibody: synthetic peptide directed towards the middle region of human TMPRSS11D. Synthetic peptide located within the following region: IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC

Rabbit Polyclonal Anti-TMPRSS11D Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human TMPRSS11D