Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%). |
OR8B8 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 283-312 amino acids from the C-terminal region of human Olfactory receptor 8B8 |
OR51E1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | OR51E1 antibody was raised against synthetic 17 amino acid peptide from internal region of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Marmoset, Mouse, Hamster, Rabbit (88%); Gibbon, Galago, Rat (82%). |
Rabbit Polyclonal anti-OR13C9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR |
Rabbit Polyclonal anti-OR13C9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR |
OR6N1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Hamster, Human, Mouse, Rabbit, Rat |
| Immunogen | OR6N1 antibody was raised against synthetic 15 amino acid peptide from 1st extracellular domain of human OR6N1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Rabbit, Opossum (100%); Marmoset, Dog (93%); Panda, Bovine, Horse, Pig (87%). |
OR2A4 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR2A4 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human OR2A4. Percent identity with other species by BLAST analysis: Human (100%). |
Rabbit Polyclonal Anti-OR51E1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E1 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (95%); Gibbon, Galago (89%); Marmoset, Panda (84%). |
Rabbit Polyclonal Anti-OR51E1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR51E1 antibody was raised against synthetic 16 amino acid peptide from internal region of human OR51E1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Panda, Rabbit, Horse, Pig (100%); Galago, Bat, Elephant (94%); Opossum (88%). |
Rabbit Polyclonal Anti-OR10J5 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | OR10J5 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human OR10J5. Percent identity with other species by BLAST analysis: Human, Gibbon, Elephant, Horse (100%); Gorilla, Hamster, Dog (94%); Mouse, Rat, Panda (88%); Bovine, Pig (81%). |
Anti-CLCA4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 306-476 amino acids of Human Calcium-activated chloride channel regulator 4 |
Rabbit Polyclonal Anti-ADCY3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ADCY3 |
Germany
Japan
United Kingdom
China
