Primary Antibodies

Jump to Filters
View as table Download
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA329901

USD 375.00

5 Days

Rabbit Polyclonal Anti-DVL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA350653

USD 345.00

In Stock

Rabbit Polyclonal Anti-DVL2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human DVL2
Dishevelled 2 (DVL2) Rabbit Polyclonal Antibody
TA375663

USD 220.00

3 Weeks

DVL2 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human DVL2 (NP_004413.1).
Modifications Unmodified