Primary Antibodies

Jump to Filters
View as table Download
MAT1A Rabbit Polyclonal Antibody
TA346036

USD 410.00

5 Days

Rabbit Polyclonal Anti-MAT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE
MAT1A (N-term) Rabbit Polyclonal Antibody
AP52613PU-N

USD 450.00

2 Weeks

MAT1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 114-144 amino acids from the N-terminal region of human MAT1A