Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CPE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG

CPE rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPE

CPE rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CPE