Primary Antibodies

Jump to Filters
View as table Download
KCNIP4 Rabbit Polyclonal Antibody
TA337256

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNIP4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNIP4 antibody: synthetic peptide directed towards the N terminal of human KCNIP4. Synthetic peptide located within the following region: NSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELL
KCNIP4 Rabbit Polyclonal Antibody
TA366183

USD 380.00

4 Weeks

KCNIP4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNIP4
KCNIP4 Rabbit Polyclonal Antibody
TA370535

USD 380.00

4 Weeks

KCNIP4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human KCNIP4