Rabbit Polyclonal Anti-TMPRSS11D Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS11D antibody: synthetic peptide directed towards the N terminal of human TMPRSS11D. Synthetic peptide located within the following region: RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA |
Rabbit Polyclonal Anti-TMPRSS11D Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS11D antibody: synthetic peptide directed towards the middle region of human TMPRSS11D. Synthetic peptide located within the following region: IHSVCLPAATQNIPPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVC |
Germany
Japan
United Kingdom
China
