Rabbit Polyclonal Anti-Cyclin G Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cyclin G Antibody: A synthesized peptide derived from human Cyclin G |
Rabbit Polyclonal Anti-Cyclin G Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cyclin G Antibody: A synthesized peptide derived from human Cyclin G |
Rabbit polyclonal anti-Cyclin G antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin G. |
Cyclin G (CCNG1) (C-term) rabbit polyclonal antibody, Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 249-280 amino acids from the C-terminal region of human CCNG1 |
Cyclin G (CCNG1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 20-53 amino acids from the N-terminal region of human CCNG1 |
Cyclin G (CCNG1) (N-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 27-61 amino acids from the N-terminal region of human CCNG1 |
Rabbit Polyclonal Anti-CCNG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCNG1 antibody: synthetic peptide directed towards the N terminal of human CCNG1. Synthetic peptide located within the following region: IEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARL |
Rabbit anti Cyclin G1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to C-terminal of human cyclin G1. This sequence is identical to human, mouse and rat. |
CCNG1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CCNG1 |
Cyclin G1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-295 of human Cyclin G1 (NP_004051.1). |
Modifications | Unmodified |
Cyclin G1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Cyclin G1 (NP_004051.1). |
Modifications | Unmodified |