Rabbit Polyclonal Anti-FOXG1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | FOXG1 antibody was raised against an 18 amino acid peptide near the center of human FOXG1. |
Rabbit Polyclonal Anti-FOXG1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | FOXG1 antibody was raised against an 18 amino acid peptide near the center of human FOXG1. |
Rabbit polyclonal FOXG1 Antibody (Center)
Applications | FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This FOXG1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 225-252 amino acids from the Central region of human FOXG1. |
Rabbit Polyclonal Anti-FOXG1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXG1A antibody: synthetic peptide directed towards the N terminal of human FOXG1A. Synthetic peptide located within the following region: GAPEGQRQLAQGDRRGRGICPVGPDEKEKARAGGEEKKGAGEGGKDGEGG |
Rabbit Polyclonal Anti-FOXG1B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXG1B antibody: synthetic peptide directed towards the N terminal of human FOXG1B. Synthetic peptide located within the following region: MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHH |
Rabbit Polyclonal anti-FOXG1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXG1 antibody: synthetic peptide directed towards the N terminal of human FOXG1. Synthetic peptide located within the following region: QQQPPPPPPPAPQPPQTRGAPAADDDKGPQQLLLPPPPPPPPAAALDGAK |
Rabbit Polyclonal Anti-FOXG1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FOXG1B antibody: synthetic peptide directed towards the C terminal of human FOXG1B. Synthetic peptide located within the following region: STSMSARATSSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQ |
Rabbit Polyclonal Anti-FOXG1 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXG1 |
FOXG1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human FOXG1 |
FOXG1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human FOXG1. |