Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FOXG1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FOXG1 antibody was raised against an 18 amino acid peptide near the center of human FOXG1.

Rabbit polyclonal FOXG1 Antibody (Center)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This FOXG1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 225-252 amino acids from the Central region of human FOXG1.

Rabbit Polyclonal Anti-FOXG1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXG1A antibody: synthetic peptide directed towards the N terminal of human FOXG1A. Synthetic peptide located within the following region: GAPEGQRQLAQGDRRGRGICPVGPDEKEKARAGGEEKKGAGEGGKDGEGG

Rabbit Polyclonal Anti-FOXG1B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXG1B antibody: synthetic peptide directed towards the N terminal of human FOXG1B. Synthetic peptide located within the following region: MLDMGDRKEVKMIPKSSFSINSLVPEAVQNDNHHASHGHHNSHHPQHHHH

Rabbit Polyclonal anti-FOXG1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXG1 antibody: synthetic peptide directed towards the N terminal of human FOXG1. Synthetic peptide located within the following region: QQQPPPPPPPAPQPPQTRGAPAADDDKGPQQLLLPPPPPPPPAAALDGAK

Rabbit Polyclonal Anti-FOXG1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXG1B antibody: synthetic peptide directed towards the C terminal of human FOXG1B. Synthetic peptide located within the following region: STSMSARATSSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQ

Rabbit Polyclonal Anti-FOXG1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXG1

FOXG1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOXG1

FOXG1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human FOXG1.