Primary Antibodies

Jump to Filters
View as table Download
GNG3 Rabbit Polyclonal Antibody
TA331327

USD 375.00

5 Days

Rabbit Polyclonal Anti-GNG3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GNG3 antibody is: synthetic peptide directed towards the middle region of Human GNG3. Synthetic peptide located within the following region: IEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCAL
GNG3 Rabbit Polyclonal Antibody
TA376656

USD 220.00

3 Weeks

GNG3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-75 of human GNG3 (NP_036334.1).
Modifications Unmodified