GIRK1 (KCNJ3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 150-200 of Human KIR3.1. |
GIRK1 (KCNJ3) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 150-200 of Human KIR3.1. |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
Rabbit polyclonal Anti-Kir3.1 (GIRK1)
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GST fusion protein with sequence LQRISSVPGNSEEKLVSKT TKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKM NSDRFT, corresponding to residues 437-501 of mouse GIRK1, (MW: 34 kDa.). Intracellular, C-terminus. |
Kcnj3 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
KCNJ3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ3 (NP_002230.1). |
Modifications | Unmodified |
KCNJ3 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ3 (NP_002230.1). |
Modifications | Unmodified |