Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-KIR3DL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIR3DL2 antibody is: synthetic peptide directed towards the C-terminal region of Human KIR3DL2. Synthetic peptide located within the following region: LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ

KIR3DL2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KIR3DL2 antibody is: synthetic peptide directed towards the C-terminal region of Human KI3L2

KIR3DL2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 361-455 of human KIR3DL2 (NP_006728.2).
Modifications Unmodified