Rabbit polyclonal LRP8 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LRP8. |
Rabbit polyclonal LRP8 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LRP8. |
Rabbit Polyclonal Anti-LRP8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRP8 Antibody: synthetic peptide directed towards the middle region of human LRP8. Synthetic peptide located within the following region: ATVDGGRRRTLFSRNLSEPRAIAVDPLRGFMYWSDWGDQAKIEKSGLNGV |
Rabbit Polyclonal Apolipoprotein E R2/ApoE R2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human ApoER2 protein sequence (between residues 863-963). [UniProt# Q14114] |
Rabbit Polyclonal Apolipoprotein E R2/ApoE R2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human ApoER2 protein sequence (between residues 800-900). [UniProt# Q14114] |
ApoER2/LRP8 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 900 to the C-terminus of human ApoER2/ApoER2/LRP8 (NP_004622.2). |
Modifications | Unmodified |
ApoER2 Rabbit polyclonal Antibody
Applications | IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human ApoER2 |