Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PHKG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PHKG2 Antibody: synthetic peptide directed towards the N terminal of human PHKG2. Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV

Rabbit Polyclonal Anti-PHKG2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PHKG2

PHKG2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 237-406 of human PHKG2 (NP_000285.1).
Modifications Unmodified

PHKG2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 237-406 of human PHKG2 (NP_000285.1).
Modifications Unmodified