Anti-PSMD5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 2-250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 5 |
Anti-PSMD5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 2-250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 5 |
Rabbit Polyclonal Anti-PSMD5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMD5 Antibody is: synthetic peptide directed towards the C-terminal region of Human PSMD5. Synthetic peptide located within the following region: FEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQS |
PSMD5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 255-504 of human PSMD5 (NP_005038.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China