Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RHOJ Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RHOJ antibody: synthetic peptide directed towards the middle region of human RHOJ. Synthetic peptide located within the following region: LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK

RHOJ (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human