Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-AGK Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGK antibody: synthetic peptide directed towards the N terminal of human AGK. Synthetic peptide located within the following region: DNLLRRAACQEAQVFGNQLIPPNAQVKKATVFLNPAACKGKARTLFEKNA

Rabbit Polyclonal Anti-AGK Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGK antibody: synthetic peptide directed towards the N terminal of human AGK. Synthetic peptide located within the following region: KKLLELMENTDVIIVAGGDGTLQEVVTGVLRRTDEATFSKIPIGFIPLGE

AGK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human AGK

AGK Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AGK

AGK Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 233-422 of human AGK (NP_060708.1).
Modifications Unmodified