Rabbit Polyclonal Anti-CREB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the middle region of human CREB3. Synthetic peptide located within the following region: SRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSST |
Rabbit Polyclonal Anti-CREB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the C terminal of human CREB3. Synthetic peptide located within the following region: YSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLD |
Rabbit Polyclonal Anti-CREB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB3 antibody: synthetic peptide directed towards the middle region of human CREB3. Synthetic peptide located within the following region: PPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG |
CREB3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human CREB3 (NP_006359.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China