DDX6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 354~384 amino acids from the Central region of Human DDX6. |
DDX6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 354~384 amino acids from the Central region of Human DDX6. |
Rabbit Polyclonal Anti-DDX6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYL |
Rabbit Polyclonal Anti-DDX6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DDX6 antibody: synthetic peptide directed towards the N terminal of human DDX6. Synthetic peptide located within the following region: KTLKLPPKDLRIKTSDVTSTKGNEFEDYCLKRELLMGIFEMGWEKPSPIQ |
DDX6 Antibody - N-terminal region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of mouse DDX6 |
DDX6 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human DDX6 (NP_001244120.1). |
Modifications | Unmodified |