Primary Antibodies

View as table Download

Rabbit polyclonal anti-GLPK antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human GLPK.

Rabbit Polyclonal Anti-GK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GK Antibody: A synthesized peptide derived from human GK

Rabbit polyclonal anti-Glycerol Kinase / GLPK3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLPK3.

Glycerol kinase (GK) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of Human Glycerol kinase

Rabbit Polyclonal Anti-GK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GK Antibody: synthetic peptide directed towards the middle region of human GK. Synthetic peptide located within the following region: MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS

Rabbit Polyclonal Anti-Gyk Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gyk Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Gyk. Synthetic peptide located within the following region: DKVTGEPLYNAVVWLDLRTQSTVENLSKRIPGNNNFVKSKTGLPLSTYFS

Rabbit Polyclonal Anti-GK Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GK

GK rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GK

Glycerol kinase (GK) Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 251-530 of human Glycerol kinase (Glycerol kinase (GK)) (NP_976325.1).
Modifications Unmodified