Primary Antibodies

Jump to Filters
View as table Download
LDL Receptor (LDLR) Rabbit Polyclonal Antibody
TA336722

USD 479.00

2 Weeks

Rabbit Polyclonal LDL R Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human LDL Receptor protein (within residues 500-550). [Swiss-Prot# P01130]
LDL Receptor (LDLR) Rabbit Polyclonal Antibody
TA335244

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-LDLR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LDLR antibody is: synthetic peptide directed towards the C-terminal region of Human LDLR. Synthetic peptide located within the following region: VDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEA
LDL Receptor (LDLR) (500-550) Rabbit Polyclonal Antibody
RA25068-100

USD 370.00

2 Weeks

LDL Receptor (LDLR) (500-550) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
LDLR Rabbit Polyclonal Antibody
TA367505

USD 380.00

4 Weeks

LDLR rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human LDLR
LDL Receptor (LDLR) Rabbit Polyclonal Antibody
TA377985

USD 220.00

3 Weeks

LDL Receptor (LDLR) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human LDL Receptor (LDLR) (NP_000518.1).
Modifications Unmodified