Rabbit anti-SMARCA5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMARCA5 |
Rabbit anti-SMARCA5 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMARCA5 |
Rabbit Polyclonal anti-SMARCA5 antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5. Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE |
Rabbit Polyclonal Anti-SMARCA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5. Synthetic peptide located within the following region: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAVSA |
Rabbit polyclonal anti-SNF2H antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SNF2H |
Rabbit Polyclonal Anti-SMARCA5 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SMARCA5 |
SMARCA5 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human SNF2H |
SMARCA5 Rabbit monoclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |