Primary Antibodies

Jump to Filters
View as table Download
UPP2 (C-term) Rabbit Polyclonal Antibody
AP54478PU-N

USD 450.00

2 Weeks

UPP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 217-244 amino acids from the C-terminal region of human UPP2
Upp2 Rabbit Polyclonal Antibody
TA330993

USD 375.00

5 Days

Rabbit polyclonal Anti-Upp2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Upp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SREIPNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRAG
UPP2 Rabbit Polyclonal Antibody
TA351904

USD 345.00

In Stock

Rabbit Polyclonal Anti-UPP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UPP2
UPP2 Rabbit Polyclonal Antibody
TA367356

USD 380.00

4 Weeks

UPP2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UPP2