CLDN3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CLDN3 |
CLDN3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CLDN3 |
Rabbit polyclonal anti-Claudin 3 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Claudin 3. |
Rabbit Polyclonal Anti-Claudin 3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Claudin 3 Antibody: A synthesized peptide derived from human Claudin 3 |
Rabbit polyclonal Claudin 3 (Tyr219) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Claudin 3 around the phosphorylation site of tyrosine 219 (R-K-D-YP-V). |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-Cldn3 antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cldn3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPRDKYAPTKILYSAP |
Rabbit anti Claudin 3 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-CLDN3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 207-220 amino acids of Human claudin 3 |
Anti-CLDN3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 207-220 amino acids of Human claudin 4 |
CLDN3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 141-220 of human CLDN3 (NP_001297.1). |
Modifications | Unmodified |