Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to DUSP8 (dual specificity phosphatase 8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 44 of DUSP8 (Uniprot ID#Q13202)

Rabbit Polyclonal Anti-DUSP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP8 antibody: synthetic peptide directed towards the middle region of human DUSP8. Synthetic peptide located within the following region: PAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRP

Anti-DUSP8 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human dual specificity phosphatase 8

Anti-DUSP8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human dual specificity phosphatase 8

DUSP8 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DUSP8
Modifications Unmodified