Primary Antibodies

View as table Download

HSPE1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSPE1

Rabbit Polyclonal Anti-HSPE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HSPE1

Rabbit polyclonal anti-HSP10 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP10.

Rabbit Polyclonal Anti-HSP10 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HSP10 Antibody: A synthesized peptide derived from human HSP10

Rabbit polyclonal Cpn10 Antibody

Applications IHC, WB
Reactivities Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig
Conjugation Unconjugated
Immunogen Human Cpn10 peptide AA 91-101

Rabbit Polyclonal Anti-HSPE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HSPE1 antibody: synthetic peptide directed towards the middle region of human HSPE1. Synthetic peptide located within the following region: GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD

HSPE1/HSP10/CPN10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-102 of human HSPE1/HSP10/CPN10 (NP_002148.1).
Modifications Unmodified