Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: EIIVKIFVEFSIASETHKAIQALNGRWFAGRKVVAEVYDQERFDNSDLSA

Rabbit Polyclonal Anti-PUF60 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PUF60 antibody: synthetic peptide directed towards the C terminal of human PUF60. Synthetic peptide located within the following region: PPIPVTIPSVGVVNPILASPPTLGLLEPKKEKEEEELFPESERPEMLSEQ

Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1)

PUF60 Rabbit polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 243-542 of human PUF60 (NP_055096.2).
Modifications Unmodified