Primary Antibodies

View as table Download

Rabbit polyclonal anti-SFRS7 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SFRS7.

SFRS7 (SRSF7) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 69-98 amino acids from the N-terminal region of Human SFRS7

Rabbit Polyclonal Anti-SFRS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the N terminal of human SFRS7. Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA

Rabbit Polyclonal Anti-SFRS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the middle region of human SFRS7. Synthetic peptide located within the following region: SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP

SRSF7 Antibody - C-terminal

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human SRSF7

SRSF7 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human SRSF7 (NP_001026854).
Modifications Unmodified