Primary Antibodies

View as table Download

UGP2 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Uridine-5’-diphosphoglucose Pyrophosphorylase isolated and purified from Bovine liver.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

UGP2 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Uridine-5’-diphosphoglucose Pyrophosphorylase isolated and purified from Bovine liver.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit Polyclonal Anti-UGP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGP2 antibody: synthetic peptide directed towards the N terminal of human UGP2. Synthetic peptide located within the following region: TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN

Rabbit Polyclonal Anti-UGP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human UGP2

UGP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human UGP2