Rabbit polyclonal Anti-ASIC4
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CKIKFAEEDAKPKEKEAGDE, corresponding to amino acid residues 7-26 of rat ASIC4.? Intracellular, N-terminus. |
Rabbit polyclonal Anti-ASIC4
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CKIKFAEEDAKPKEKEAGDE, corresponding to amino acid residues 7-26 of rat ASIC4.? Intracellular, N-terminus. |
Rabbit Polyclonal Anti-ACCN4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the middle region of human ACCN4. Synthetic peptide located within the following region: NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS |
Rabbit Polyclonal Anti-ACCN4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACCN4 antibody: synthetic peptide directed towards the N terminal of human ACCN4. Synthetic peptide located within the following region: SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA |
ASIC4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ASIC4 |
ASIC4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ACCN4 |