Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CNTNAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNTNAP1 antibody: synthetic peptide directed towards the N terminal of human CNTNAP1. Synthetic peptide located within the following region: LQIDLMKKHRIRAVATQGSFNSWDWVTRYMLLYGDRVDSWTPFYQRGHNS

CNTNAP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CNTNAP1

Caspr1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human Caspr1 (NP_003623.1).
Modifications Unmodified