DUSP5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DUSP5 |
DUSP5 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DUSP5 |
Rabbit Polyclonal Anti-DUSP5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: ANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFID |
Rabbit Polyclonal Anti-DUSP5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS |
DUSP5 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DUSP5 |
DUSP5 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 315-384 of human DUSP5 (NP_004410.3). |
Modifications | Unmodified |