Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FGA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGA antibody: synthetic peptide directed towards the N terminal of human FGA. Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS

Rabbit Polyclonal Anti-FGA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGA antibody: synthetic peptide directed towards the middle region of human FGA. Synthetic peptide located within the following region: SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK

Rabbit polyclonal FGA Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FGA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 116-144 amino acids from the N-terminal region of human FGA.

Fibrinogen alpha chain (FGA) Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Fibrinogen alpha chain (Fibrinogen alpha chain (FGA)) (NP_068657.1).
Modifications Unmodified

Recombinant Anti-D-Dimer (Clone 3B6)

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG3 format, for improved compatibility with existing reagents, assays and techniques.