Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751)

Rabbit polyclonal anti-LAMB3 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LAMB3.

Rabbit Polyclonal Anti-LAMB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAMB3 antibody: synthetic peptide directed towards the middle region of human LAMB3. Synthetic peptide located within the following region: ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD

Rabbit Polyclonal Anti-LAMB3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human LAMB3

LAMB3 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 18-230 of human LAMB3 (NP_000219.2).
Modifications Unmodified