Rabbit Polyclonal Anti-PPP2R5C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C. Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK |
PP2A-B56γ/PR61γ/PPP2R5C Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human PP2A-B56γ/PR61γ/PP2A-B56γ/PR61γ/PPP2R5C (NP_848702.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China