Primary Antibodies

View as table Download

Rabbit polyclonal anti-TNFSF15 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human TNFSF15.

Biotinylated Anti-Human TL-1A Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TL-1A

Anti-Human TL-1A Rabbit Polyclonal Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TL-1A

Rabbit Polyclonal anti-TNFSF15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TNFSF15 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFSF15. Synthetic peptide located within the following region: CSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQP

Rabbit Polyclonal Anti-TNFSF15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF15

TNFSF15 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TNFSF15

TNFSF15 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TNFSF15

Recombinant Anti-TL1A (Clone TAN2-2)

Applications Bl, FC, IF
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques.