Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HACE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HACE1 antibody: synthetic peptide directed towards the middle region of human HACE1. Synthetic peptide located within the following region: DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRV

Rabbit Polyclonal Anti-HACE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HACE1 antibody is: synthetic peptide directed towards the N-terminal region of Human HACE1. Synthetic peptide located within the following region: RARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYAFGRVKR

Rabbit Polyclonal Anti-HACE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human HACE1