Rabbit Polyclonal Anti-TOMM40L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD |
Rabbit polyclonal anti-Tom 40 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 339 of human TOM40 |
Rabbit Polyclonal Anti-TOMM40L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TOMM40L antibody: synthetic peptide directed towards the middle region of human TOMM40L. Synthetic peptide located within the following region: GGAHASYYHRANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQANMVFRGL |
Germany
Japan
United Kingdom
China