Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2. Synthetic peptide located within the following region: QDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQG

Rabbit polyclonal anti-COT2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human COT2.

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the C terminal of human NR2F2. Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF

Rabbit polyclonal NR2F2 Antibody (N-term)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This NR2F2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human NR2F2.

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2. Synthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the N terminal of human NR2F2. Synthetic peptide located within the following region: AMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPAST

Rabbit Polyclonal Anti-NR2F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NR2F2