Germany
Japan
United Kingdom
China
SPINT1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 178-207 amino acids from the Central region of human SPINT |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-SPINT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPINT1 Antibody: synthetic peptide directed towards the middle region of human SPINT1. Synthetic peptide located within the following region: PFSEHCARFTYGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPS |
Anti-SPINT1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 36-140 amino acids of human serine peptidase inhibitor, Kunitz type 1 |
Active filters
Target Symbol
- SPINT1
Antibody Hosts
- Rabbit
Families
- Transmembrane