Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ApoA4 Antibody
| Applications | WB |
| Reactivities | Chicken, Human |
| Conjugation | Unconjugated |
| Immunogen | ApoA4 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of chicken ApoA4. |
Primary Antibodies
View as table Download
Rabbit Polyclonal ApoA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | ApoA4 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human ApoA4. |
Rabbit Polyclonal Anti-APOA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for Anti-APOA4 Antibody: synthetic peptide directed towards the C terminal of human APOA4. Synthetic peptide located within the following region: RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ |
APOA4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 227-396 of human APOA4 (NP_000473.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- APOA4
Antibody Hosts
- Rabbit
Isotypes
- IgG