Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-IFRD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFRD1 antibody: synthetic peptide directed towards the N terminal of human IFRD1. Synthetic peptide located within the following region: VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL

Rabbit Polyclonal Anti-IFRD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFRD1 antibody: synthetic peptide directed towards the middle region of human IFRD1. Synthetic peptide located within the following region: LALLFELARGIESDFFYEDMESLTQMLRALATDGNKHRAKVDKRKQRSVF

Rabbit Polyclonal Anti-IFRD1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IFRD1

IFRD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IFRD1

IFRD1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human IFRD1 (NP_001541.2).
Modifications Unmodified

IFRD1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human IFRD1 (NP_001541.2).
Modifications Unmodified