Primary Antibodies

Jump to Filters
View as table Download
NEK6 Rabbit Polyclonal Antibody
TA346770

USD 475.00

5 Days

Rabbit Polyclonal Anti-NEK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEK6 antibody: synthetic peptide directed towards the N terminal of human NEK6. Synthetic peptide located within the following region: FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR
NEK6 Rabbit Polyclonal Antibody
TA379049

USD 220.00

3 Weeks

NEK6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 35-347 of human NEK6 (NP_001159643.1).
Modifications Unmodified