Rabbit polyclonal SLC25A6 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SLC25A6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-155 amino acids from the Central region of human SLC25A6. |
Rabbit Polyclonal Anti-SLC25A6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC25A6 antibody: synthetic peptide directed towards the N terminal of human SLC25A6. Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ |
Rabbit polyclonal anti-SLC25A6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC25A6. |
SLC25A6 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-298 of human SLC25A6 (NP_001627.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
