Rabbit Polyclonal Anti-SREBF1 Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SREBF1 antibody was raised against a 17 amino acid peptide near the center of human SREBF1. |
Rabbit Polyclonal Anti-SREBF1 Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | SREBF1 antibody was raised against a 17 amino acid peptide near the center of human SREBF1. |
Rabbit Polyclonal anti-SPIB antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPIB antibody: synthetic peptide directed towards the C terminal of human SPIB. Synthetic peptide located within the following region: GQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRRA |
Rabbit Polyclonal Anti-SPIB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SPIB Antibody: synthetic peptide directed towards the middle region of human SPIB. Synthetic peptide located within the following region: WGQQKGNRKRMTYQKLARALRNYAKTGEIRKVKRKLTYQFDSALLPAVRR |
SPIB Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-262 of human SPIB (NP_003112.2). |
Modifications | Unmodified |