Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-UXS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UXS1 antibody: synthetic peptide directed towards the middle region of human UXS1. Synthetic peptide located within the following region: LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH

UXS1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human UXS1