Primary Antibodies

Jump to Filters
View as table Download
ZIC3 Rabbit Polyclonal Antibody
TA334005

USD 375.00

5 Days

Rabbit Polyclonal Anti-ZIC3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-ZIC3 Antibody: synthetic peptide directed towards the N terminal of human ZIC3. Synthetic peptide located within the following region: HHHHHTSQVPSYGGAASAAFNSTREFLFRQRSSGLSEAASGGGQHGLFAG
ZIC3 Rabbit Polyclonal Antibody
TA383498

USD 220.00

3 Weeks

ZIC3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human ZIC3 (NP_003404.1).
Modifications Unmodified