Primary Antibodies

View as table Download

Rabbit Polyclonal RFX-AP Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFX-AP antibody: RFXAP (Regulatory factor X-associated protein), using the recombinant protein.

Rabbit Polyclonal Anti-RFXAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RFXAP Antibody: synthetic peptide directed towards the middle region of human RFXAP. Synthetic peptide located within the following region: SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLE